VividLex

Home / Thesaurus / cycle of fifths

Thesaurus: cycle of fifths

cycle of fifths (plural cycles of fifths) (music theory) A sequence of bass notes at intervals of a perfect fifth lower than the previous note. In equal temperament the sequence repeats every twelve tones, forming a cycl…

Full dictionary entry Search Lens associations

Related headwords

cycledefinitionfifthsdefinitionsequencedefinitioncyclesdefinitionbassdefinitionequaldefinitionfifthdefinitionformingdefinitionintervalsdefinitionlowerdefinitionmusicdefinitionnotedefinitionnotesdefinitionperfectdefinitionpluraldefinitionpreviousdefinitionrepeatsdefinitiontemperamentdefinitiontheorydefinitiontonesdefinitiontwelvedefinitioncycle of rebirthfamilycycle onfamilycycle per secondfamilycycle rickshawfamilycycledfamilycycles/secondfamilycycletracksfamily

Definitions

  1. cycle of fifths (plural cycles of fifths) (music theory) A sequence of bass notes at intervals of a perfect fifth lower than the previous note. In equal temperament the sequence repeats every twelve tones, forming a cycle.