VividLex

Home / Thesaurus / mapping

Thesaurus: mapping

of Map

Full dictionary entry Search Lens associations

Related headwords

processdefinitionchromosomedefinitionelementdefinitionfunctiondefinitiongenesdefinitiongeneticsdefinitionlocatingdefinitionsetdefinitionmapsdefinitionassociateddefinitiondomaindefinitiongivendefinitionmakingdefinitionmapdefinitionmathematicaldefinitionmathematicsdefinitionrangedefinitionrelationdefinitionmappingsfamilymaple-likeneighbormaplelikeneighbormaplesneighbormaplessneighbormaplikeneighbormapmakingneighbormappedneighbormapperneighbormappersneighbor

Definitions

  1. p. pr. & vb. n. of Map
  2. n. (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
  3. n. the process of making maps
  4. n. (genetics) the process of locating genes on a chromosome
  5. n:100 n. (genetics) the process of locating genes on a chromosome