Thesaurus: mapping
of Map
Related headwords
processdefinitionchromosomedefinitionelementdefinitionfunctiondefinitiongenesdefinitiongeneticsdefinitionlocatingdefinitionmapsdefinitionassociateddefinitiondomaindefinitiongivendefinitionmakingdefinitionmathematicaldefinitionmathematicsdefinitionrangedefinitionmappingsfamilymaple-likeneighbormaplelikeneighbormaplesneighbormaplessneighbormaplikeneighbormapmakingneighbormappedneighbormapperneighbormappersneighbormapperyneighbormapquestneighborMapuchizationneighbor
Definitions
- p. pr. & vb. n. of Map
- n. (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function)
- n. the process of making maps
- n. (genetics) the process of locating genes on a chromosome
- n:100 n. (genetics) the process of locating genes on a chromosome