Thesaurus: phrases
n an expression consisting of one or more words forming a grammatical constituent of a sentence n a short musical passage n an expression whose meanings cannot be inferred from the meanings of the words that make it up n…
Related headwords
expressiondefinitionwordsdefinitionmeaningsdefinitioncannotdefinitionchoreographicdefinitioncombinedefinitionconsistingdefinitionconstituentdefinitiondancedefinitiondividedefinitionformingdefinitiongrammaticaldefinitioninferreddefinitionlinkeddefinitionmarkdefinitionmovementsdefinitionmusicaldefinitionpassagedefinitionsentencedefinitionsequencedefinitionshortdefinitionsingledefinitionphrase-booksfamilyphrase-lengthsfamilyphrasedfamilyphraselessfamilyphraseogramfamilyphraseologicfamily
Definitions
- n an expression consisting of one or more words forming a grammatical constituent of a sentence n a short musical passage n an expression whose meanings cannot be inferred from the meanings of the words that make it up n dance movements that are linked in a single choreographic sequence v put into words or an expression v divide, combine, or mark into phrases