Thesaurus: receptor
a cellular structure that is postulated to exist in order to mediate between a chemical agent that acts on nervous tissue and the physiological response
Related headwords
actsdefinitionagentdefinitioncellulardefinitionchemicaldefinitionexistdefinitionmediatedefinitionnervousdefinitionorderdefinitionphysiologicaldefinitionpostulateddefinitionresponsedefinitionstructuredefinitiontissuedefinitionendingsdefinitionmouthdefinitionnervedefinitionnosedefinitionorgandefinitionresponddefinitionskindefinitionvisceradefinitionreception roomfamilyreception-roomsfamilyreceptionistfamilyreceptionistsfamilyreceptionsfamilyreceptivefamilyreceptive aphasiafamily
Definitions
- n. a cellular structure that is postulated to exist in order to mediate between a chemical agent that acts on nervous tissue and the physiological response
- n. an organ having nerve endings (in the skin or viscera or eye or ear or nose or mouth) that respond to stimulation
- n:100 n. a cellular structure that is postulated to exist in order to mediate between a chemical agent that acts on nervous tissue and the physiological response