Thesaurus: switched
of Switch
Related headwords
exchangedefinitionchangedefinitionswitchdefinitionabandondefinitionactiondefinitionarounddefinitionasidedefinitionattitudedefinitioncausedefinitioncoursedefinitiondirectiondefinitionengageddefinitionflexibledefinitionflogdefinitiongivedefinitionleavedefinitionoperationdefinitionorderdefinitionreversedefinitionsequencedefinitionshiftdefinitionsomethingdefinitionswitch-hitterfamilyswitch-ivyfamilyswitchbackedfamilyswitchbackingfamilyswitchbladefamilyswitchblade knifefamily
Definitions
- imp. & p. p. of Switch
- j:100 v change over, change around, as to a new order or sequence v exchange or give (something) in exchange for v lay aside, abandon, or leave for another v make a shift in or exchange of; then we switched" v cause to go on or to be engaged or set in operation v flog with or as if with a flexible rod v reverse (a direction, attitude, or course of action)