Thesaurus: parvo
any of a group of viruses containing DNA in an icosahedral protein shell and causing disease in dogs and cattle; not known to be associated with any human disease
Related headwords
diseasedefinitionassociateddefinitioncattledefinitioncausingdefinitioncontainingdefinitionDNAdefinitiondogsdefinitiongroupdefinitionhumandefinitionicosahedraldefinitionknowndefinitionproteindefinitionshelldefinitionvirusesdefinitionparvolinfamilyparvolinefamilyparvovirusfamilyparvowinchitefamilyparvanimityneighborparvatineighborparveneighborparvenuneighborparvenueneighborparvenusneighborparvisneighborparviseneighborparvitudeneighborparvityneighbor
Definitions
- n. any of a group of viruses containing DNA in an icosahedral protein shell and causing disease in dogs and cattle; not known to be associated with any human disease
- n any of a group of viruses containing DNA in an icosahedral protein shell and causing disease in dogs and cattle; not known to be associated with any human disease